Protein Info for GFF542 in Xanthobacter sp. DMC5

Annotation: Magnesium transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 305 to 324 (20 residues), see Phobius details amino acids 332 to 357 (26 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 443 to 466 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 33 to 466 (434 residues), 332.3 bits, see alignment E=2.2e-103 PF03448: MgtE_N" amino acids 51 to 152 (102 residues), 75.1 bits, see alignment E=8.7e-25 PF00571: CBS" amino acids 227 to 273 (47 residues), 33.9 bits, see alignment 5e-12 PF01769: MgtE" amino acids 338 to 461 (124 residues), 123.2 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 85% identity to xau:Xaut_4084)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>GFF542 Magnesium transporter MgtE (Xanthobacter sp. DMC5)
MRDDADEAGAEVMPLTVRDEDGNLSDSFRNRVNEAIEARDVDALKALVGDLHEADMGDLI
EELDADERRRLIELLGPAFDFTALTELDETVRVSILRSLSPITVARGMRDLDSDDAVYIL
EDLDEDEMAAVLEHLPAPERVALQRSLDYPEESAGRRMQTEFIAVPPFWTVGRTIDYMRE
TADLPDTFYEVFVVDPAYRLVGSVPLDRLLRTRRPVLMSAVKAEQAKVVKASEDQEDVAR
MFERYNLVSAPVVDDAGRLVGVMTIDDVVDVIQEEADEDLRALGGVRSDEELSDTVAFTA
RSRLPWLVVNLGTAFVSASIISLFEGTIEKMVALAILMPIVASMGGNAGTQTMTVAVRAL
ATKELSSHNARRIVLREVLVGLVNGTTLACLLGVIAGFWFANVHLGVVISSALILNMIAA
GLFGILIPLAISKLKLDPAVASGVFVTMVTDTVGFFAFLGLATWWFAT