Protein Info for GFF542 in Sphingobium sp. HT1-2

Annotation: Uncharacterized MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 246 (227 residues), 125.8 bits, see alignment E=1e-40 amino acids 228 to 401 (174 residues), 49 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: None (inferred from 66% identity to ttu:TERTU_1266)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>GFF542 Uncharacterized MFS-type transporter (Sphingobium sp. HT1-2)
MQPMRFKEYSIVAISLFGISTGPAAFGLASIGVVSEPMTIEFGWSRTAISAAVSIMMLCT
AACLPVAGRIIDRLGARRVLIPSILLLALSMAGLAFVQSYWQFIALYIAMGTIAVGTNST
AYMRVITSWFDHRRGLAIGIAGSGTGLGFAYVPVFTQALVEHWGWRAGYLGLALILLLGT
LPLVLLAIHEAPEHDAPHDRPEARAVQQGDSIREAMRKADFWVLGGIFVVLAFVLYGLIP
HLVPLLQDRGVSAGQAAWIASLFGSAAFAGRLLIGFMVDQFDARRIAVIFFSLSALGLLL
LALPLPTWAFLPAALLLGGSLGAEVDMLAYLTSRYFGLRSFAQIFSTLFAAVMVAMGLGP
LAFGFVFDMSGSYTAILAIGAPICLVAAGMVLLLSPYAQRARGGQVTTT