Protein Info for PS417_27740 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 195 to 221 (27 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 241 (231 residues), 50 bits, see alignment E=1.1e-17 amino acids 237 to 369 (133 residues), 46.8 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU5975)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UB10 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PS417_27740 MFS transporter (Pseudomonas simiae WCS417)
MRWATYFAVLASVLSVGLALGVSMPLVSLRLESWGYGSFAIGVMAAMPAFGVLLGAKVSS
RMASWLGTANLMRLCLWAGAVSIGLLAILPSYPVWLVLRLMIGVILTIVFILGESWINQL
VVEQWRGRLVALYGCSYALSQLSGPLLLGLIGTGHDYGFWVGVGLLVVAPFLLLGRSGAP
TAESFSVTFADLWRFCLSLPAIAWAVALFAAFEAMILTLLPVYCLQQGFTAEMALAMVST
VVVGDALLQLPIGALADYLPRRTLFLSCAVLLLVSSLAIPLLMHTPLIWPVWVVFGASAG
GLFTLSLILIGERYRDDALVRANAHVAQLWGIGCLIGPLVAGAGSQWISGHALPLLMAAG
ALGLVLLLLRQGAFGAAQPL