Protein Info for GFF5408 in Variovorax sp. SCN45

Annotation: Protein serine/threonine phosphatase PrpC, regulation of stationary phase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF13672: PP2C_2" amino acids 31 to 224 (194 residues), 59.8 bits, see alignment E=3.1e-20 PF00481: PP2C" amino acids 83 to 157 (75 residues), 25.1 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K01090, protein phosphatase [EC: 3.1.3.16] (inferred from 87% identity to vpe:Varpa_5912)

Predicted SEED Role

"Protein serine/threonine phosphatase PrpC, regulation of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF5408 Protein serine/threonine phosphatase PrpC, regulation of stationary phase (Variovorax sp. SCN45)
MASVGVSLFSTRPPLTWEFAALTDVGRLRAHNEDAVHVDPALGLALLADGMGGYKGGEVA
SAMAVSLLHASFGRWFAQAGMQAPARVVRRALQAATDEANGSILHAGTTNPELQGMGTTL
VLAAFRPQRVVVGHIGDSRCYRVRNNKLELLTRDHSLRQQQLDAGAITAEEALNSPTRNL
VTRAVGVEAQVLLEMHEHSARPGDLYMLCSDGLSEMISDEQLFTLLGHDVGLQKKASLLV
SIANDNGGRDNISVVLARAGVVEPPRTAK