Protein Info for PS417_27645 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 263 to 277 (15 residues), see Phobius details PF13748: ABC_membrane_3" amino acids 25 to 261 (237 residues), 273.6 bits, see alignment E=6.7e-86

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfs:PFLU3078)

Predicted SEED Role

"probable integral membrane protein NMA1777"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQM4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PS417_27645 membrane protein (Pseudomonas simiae WCS417)
MTSVTPQILIEESKKIGQQSAGQTLKAIAKAYPGKLFGTLSLVALENALLLAYPLFAGFA
VDAIIRGDASNALFYAAVVLAFWVVGAARRALDTRTFTRIYADLAVPVILNQRLQNHSTS
KSAARVVLAREIVDFFEKHVPIIATALVSIIGAAVMLIVIEPWVGLACLGALVLCITLLP
RFAQRNQALHERLNNRLEKEIGLVEKVGAPTLRRHYQVLSRLRIWLSDREAAAYLFLGTL
AALLFVVAISQLALSPAVKAGHVYAVMTYLWTFVTSMDEAPGMVDQLARLKDIGKRVDPG
LGDR