Protein Info for PS417_27630 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 145 to 189 (45 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 287 to 326 (40 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 361 (348 residues), 77 bits, see alignment E=1.3e-25 PF05977: MFS_3" amino acids 20 to 397 (378 residues), 41.4 bits, see alignment E=6.9e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U377 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PS417_27630 MFS transporter (Pseudomonas simiae WCS417)
MPALDRRLLKIQFSFLLVVLGGRCNQLAVAWWALQETGSAVVFANMIACSIAAQVLARPL
LGWLGDKYNKILILRLVSLTSVLTALLMFFLSATQLFNPWSVGALMLISSAVAGVREPLQ
SSIIPLFARDDQVSLAVRTKSMLSSISNLLGPAMASALIFSFGTPLAFAVDFIAMLGAAV
LIASIPLHLGASAPDEPEPTSSGWRMIYSGFKAVYGVKVEFYLALVAMLVNFALFPFFTI
LLPLYVKTVIHYPITYLGLLDACFGLGILAGSYTITGWLTQRVPRDLCVAAGFALLGGNM
WLAGALSSIVVVPLAFFCGGVGLMLINIPTSAVRLLATPKQHRNRIFATVSFLSAAASPL
GSFAMNGLIANLGVTLTITSLGAMVLGLSLLVFLIPDFRTFMRAPDTQLNGAYLDKYPNA
FAR