Protein Info for GFF5391 in Variovorax sp. SCN45

Annotation: Regulatory protein RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF21982: RecX_HTH1" amino acids 10 to 47 (38 residues), 35.5 bits, see alignment E=1.2e-12 PF02631: RecX_HTH2" amino acids 59 to 92 (34 residues), 29.1 bits, see alignment 1.4e-10 PF21981: RecX_HTH3" amino acids 98 to 143 (46 residues), 51.8 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 53% identical to RECX_LEPCP: Regulatory protein RecX (recX) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K03565, regulatory protein (inferred from 95% identity to vpe:Varpa_5920)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>GFF5391 Regulatory protein RecX (Variovorax sp. SCN45)
MAFDAPSLKGRALRLLSQREHSRSELERKLAKHEEEPGTLAKALDELAAKDFISEPRVVA
SVLNQRAARSGALRVKQELQAKGIAPEAIAEAVASLQETEVERATALWRRRFDAPPADAK
ERAKQMRFLMARGFSGAVVSKVLRSDFDENHEE