Protein Info for GFF5391 in Sphingobium sp. HT1-2

Annotation: Two-component oxygen-sensor histidine kinase FixL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF08448: PAS_4" amino acids 31 to 133 (103 residues), 32 bits, see alignment E=3.8e-11 amino acids 152 to 261 (110 residues), 31.8 bits, see alignment E=4.3e-11 TIGR00229: PAS domain S-box protein" amino acids 32 to 133 (102 residues), 23.1 bits, see alignment E=3.2e-09 amino acids 141 to 266 (126 residues), 111.6 bits, see alignment E=1.4e-36 PF13426: PAS_9" amino acids 58 to 131 (74 residues), 16.5 bits, see alignment E=2.5e-06 amino acids 154 to 259 (106 residues), 47.7 bits, see alignment E=4.8e-16 PF00989: PAS" amino acids 145 to 256 (112 residues), 67.7 bits, see alignment E=2.8e-22 PF13188: PAS_8" amino acids 145 to 200 (56 residues), 30.4 bits, see alignment 7.9e-11 PF00512: HisKA" amino acids 283 to 348 (66 residues), 34.6 bits, see alignment E=4.8e-12 PF02518: HATPase_c" amino acids 396 to 500 (105 residues), 85.3 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K14986, two-component system, LuxR family, sensor kinase FixL [EC: 2.7.13.3] (inferred from 97% identity to sch:Sphch_4187)

Predicted SEED Role

"Two-component oxygen-sensor histidine kinase FixL" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF5391 Two-component oxygen-sensor histidine kinase FixL (Sphingobium sp. HT1-2)
MVDTRRGPDEIAREVVRLAPLFLRQAGGHVLTLLDPAGIVLSYNEEGERAECWPLDRVLG
QPHDLFYPPDEIAAGRPRADLAAALHEGTLEREAWRVCENGAEYLARLTISALFEGDAHR
GFACISRDVTDEAAVRASIETREQHLQSILATVPDAMIIIDETGAITSFSAAAQRLFGYS
ETELVGRNVSCLMPQPDRDRHDEYIAHYLQTGERRIIGLGRVVVGQRRDGSTFPMQLSVG
EAGEDGQRLFTGFIRDLTAKEQDELRLKELQAELVHVSRLSAMGTMASTLAHELNQPLAA
VALYLETIRDMLDERDDEPFVSLRSVMDDAAQETLRAGHIVRRLRDFVARGEVDKSLHEL
PRVIAEASQLALVDARERGIRSFFAVDPAATPVLVDRVQIQQVLVNLMRNAIEAMAECPV
RDLKVATRLRPDGLIEVTVADTGPGIADEVREQLFTAFKSTKADGMGLGLSICRTIIEAH
GGRIWMERPDRGGARFHFTLIHARAEEEHGG