Protein Info for GFF539 in Sphingobium sp. HT1-2

Annotation: Ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF07992: Pyr_redox_2" amino acids 5 to 305 (301 residues), 222 bits, see alignment E=5.7e-69 PF00070: Pyr_redox" amino acids 149 to 228 (80 residues), 63.7 bits, see alignment E=9.7e-21 PF14759: Reductase_C" amino acids 324 to 407 (84 residues), 102.1 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 76% identical to DDMA2_STEMA: Dicamba O-demethylase 2, ferredoxin reductase component (ddmA2) from Stenotrophomonas maltophilia

KEGG orthology group: None (inferred from 75% identity to npp:PP1Y_AT1991)

MetaCyc: 60% identical to carbazole 1,9a-dioxygenase ferredoxin reductase component (Sphingomonas sp. XLDN2-5)
RXN-11511 [EC: 1.14.12.22]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF539 Ferredoxin reductase (Sphingobium sp. HT1-2)
MDRADIVIVGAGHGGAQCAIALRQNGFAGTIMVVGREPEYPYERPPLSKDYFAREKAFER
LLIRPAAFWAEKHVNFLLGTEVTAVDPAGKQLTLSDGRSLGYGKLIWAAGGDPRRLTCAG
ADLAGVHAVRTRADCDALMAEIDAGKREIVVIGGGYIGLEAAAVLSKMSLKVTLLEALPR
VLARVAGEELSAFYQQVHRDHGVDLRLDARVDCLEGADGQVTAVRLADGEAIPAQAVIVG
IGIIPAVEPLIRAGAKGANGVDVDAGCRTSLPDIYAIGDCAAFACDFAGGQVMRVESVQN
ANDMATCVAKAICGDERPYRAFPWFWSNQYDLKLQTAGINAGFDQTVMRGTPADGAFSIV
YLRDGKVIALDCVNSVKDYVQGRKLIENDVQIDIDRLSDSSVALKDTVRATPAAVD