Protein Info for PS417_27570 in Pseudomonas simiae WCS417

Annotation: frataxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF01491: Frataxin_Cyay" amino acids 3 to 104 (102 residues), 93.5 bits, see alignment E=4.4e-31 TIGR03421: iron donor protein CyaY" amino acids 4 to 107 (104 residues), 112.3 bits, see alignment E=5e-37

Best Hits

Swiss-Prot: 88% identical to CYAY_PSEFS: Iron-sulfur cluster assembly protein CyaY (cyaY) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06202, CyaY protein (inferred from 87% identity to psp:PSPPH_5010)

Predicted SEED Role

"Frataxin homolog CyaY, facilitates iron supply for heme A synthesis or Fe-S cluster assembly" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTV2 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PS417_27570 frataxin (Pseudomonas simiae WCS417)
MSLTEARFHDLVDSTQQALEDIFDDSGLDVDLENSAGVLTVKFENGTQLIFSRQEPLRQL
WLAARSGGFHFDYNEEDNNWQCDTSDELLSEMLARLVLEQAGAELDFDEI