Protein Info for GFF538 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF13181: TPR_8" amino acids 51 to 83 (33 residues), 15.2 bits, see alignment (E = 1e-05) amino acids 188 to 219 (32 residues), 19.8 bits, see alignment (E = 3.4e-07) PF00515: TPR_1" amino acids 187 to 219 (33 residues), 28.7 bits, see alignment (E = 4.1e-10) PF13432: TPR_16" amino acids 190 to 237 (48 residues), 23.9 bits, see alignment 2.4e-08 PF01075: Glyco_transf_9" amino acids 446 to 477 (32 residues), 24.7 bits, see alignment (E = 7.1e-09)

Best Hits

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>GFF538 hypothetical protein (Methylophilus sp. DMC18)
MQAQHVAGLIQHTPSAPLMRLNGTPVLRPSGSTASHESPDGVLASNPAGVQAWFQKGMLF
KQQKNAPQALHCFNQALHLAPEHEPTLIECGNLLFELEQFEFSLAHHEFALQLNPACVAA
LHSKSLILSRLGRYEEALLSADHLVGYAPTLAPALLCRGSILHVLGRHHEALASYQQIPL
ADQQNALFYLNLANLYLDMLDIDMASDCYRQALALEPHNPTLHWNLALFQLLTGDYAQGW
AMYESGKHAPHLPRGRRAACVQPMWTGEQSLQGKRILLYAEQGLGDTIQFIRYAKQVSAL
GAQVIIEAQTSLIPLLRSLGPDYLLIAAGTAYQDYDYHCSLMSLPYIFKTELGNLPRHTP
YLFASPDKVSRLQMTDQNRLRIGLVWSGSTTHQKDRYRSIPLAQLAPLLALDASFHSLQK
EVRDTDLPALSELPQLTQHQAELEDFSDTAALIARMDLIISVDTSVAHLAGAMHKPVWIL
LPDPPDFRWLLAREDSPWYPSARLFRAHEHDWTSVITDVKQALAEVISEKA