Protein Info for PS417_27500 in Pseudomonas simiae WCS417

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01346: FKBP_N" amino acids 33 to 125 (93 residues), 53.4 bits, see alignment E=4e-18 PF00254: FKBP_C" amino acids 137 to 221 (85 residues), 89.7 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 54% identical to FKBZ_PSEAE: Probable FKBP-type 25 kDa peptidyl-prolyl cis-trans isomerase (fkl) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 93% identity to pfs:PFLU5928)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UFA4 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PS417_27500 peptidylprolyl isomerase (Pseudomonas simiae WCS417)
MSRYLFLVLGLAISGANASEQSPAKTTEPNQHDLAYSLGASLGERLRQEVPDLQLQALID
GLKQAYQGKPLALDNARIEQILAQHEAQTETDSQASQSEKALAAEHQFLNKEKAVKGVRE
LADGILLTELTPGTGDKPTASDQVQVKYVGRLPDGTVFDQSTQPQWFRLDSVINGWSSAL
QQMPVGAKWRLVIPSAQAYGADGAGELIPPYSPLVFEIELLGTRH