Protein Info for PS417_27470 in Pseudomonas simiae WCS417

Annotation: threonine transporter RhtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 203 (189 residues), 108.3 bits, see alignment E=1.7e-35

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 99% identity to pfs:PFLU5923)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTT3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PS417_27470 threonine transporter RhtB (Pseudomonas simiae WCS417)
MALDTWLAFFLASWIISLSPGAGAIASMSSGLQYGFLRGYWNAIGLQLGLAMQIAVVACG
LGAILATSSTAFYAIKWFGVAYLVYLAIKQWRALPMDMTDEAAVRPIGKPMAMMFRGFLV
NASNPKALVFMLAVLPQFVNPQAPLLIQYLILGATMICVDMVVMAGYTGLASKVLRLLRT
PKQQKRLNRTFAGLFVGAAGFLASLHRATA