Protein Info for GFF5365 in Variovorax sp. SCN45

Annotation: Outer membrane stress sensor protease DegS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00089: Trypsin" amino acids 106 to 263 (158 residues), 77.6 bits, see alignment E=3.1e-25 PF13365: Trypsin_2" amino acids 106 to 240 (135 residues), 122.2 bits, see alignment E=7.9e-39 PF00595: PDZ" amino acids 275 to 349 (75 residues), 38.1 bits, see alignment E=4.2e-13 PF13180: PDZ_2" amino acids 281 to 368 (88 residues), 53.8 bits, see alignment E=4.7e-18 PF17820: PDZ_6" amino acids 305 to 346 (42 residues), 36.3 bits, see alignment 9.5e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_1271)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF5365 Outer membrane stress sensor protease DegS (Variovorax sp. SCN45)
MKRTWLLFAQAVTVLLAAYFVVATLKPEWLNKRATSLGGVVSVVQAPTANPAIATPGSLA
VPAKKASPAVVSINTSKAAQRHPRSNDPWFRFFFGDQDDQPQVGLGSGVIVSTDGYILTN
NHVVEGADEIEVTLNDSRHARGKVIGTDPDTDLAVLKIELDKLPVIVLGDSDALQVGDQV
LAIGNPFGVGQTVTSGIVSALGRNQLGINNFENFIQTDAAINPGNSGGALIDVHGNLQGI
NTAIYSRSGGSMGIGFAIPVSMAKIVLEGIVKEGQVRRGWIGVEPSDLSPELAETFGVKA
DSGVIITGVLQNGPAAKAGIRPGDVITSVGEKKTDNVQALLTAVAGLKPGSTSRFALQRG
SDKMELDVTPGLRPKSPVRQVPNQQE