Protein Info for GFF5363 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Drug resistance transporter, Bcr/CflA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 351 (337 residues), 156.1 bits, see alignment E=1.2e-49 PF00083: Sugar_tr" amino acids 44 to 109 (66 residues), 24.4 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: None (inferred from 54% identity to ara:Arad_8237)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF5363 Drug resistance transporter, Bcr/CflA family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPAPATSPRLAVLIALSALAILPLNMFVPSLPNIATDLDADFALVNLAVAGYAIATAVAH
LIAGAMSDRFGRKPVALAALAVYTLASVGCSLATDITTFLVCRMLQATVIAGYAVSLAAI
RDTSDEGGAASRIGYVSSAWALAPMIGPTVGGLLDSAFGWRANFVAFAVLGLAGLWLVAF
HLKETNHHRTASFALQLKGYGELGRSLPFWAYGLCMAFGIGTLYAFLGGAPLVAAQLGGL
SSTALGAYMGLVPAGFMLGSYLVGRASSRHPPTRLILVGRVLTALGLLVGLVLMASGLTH
PLAFFGPCVFVGLGNGLTMPAANARILSLRPHLAGTASGLAAAVTVIGAGVVAFCSGLVV
NASNAHLAVLGVMWASSLLSLLVALFIVRTER