Protein Info for GFF5361 in Sphingobium sp. HT1-2

Annotation: Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 13 to 40 (28 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 251 (240 residues), 177.6 bits, see alignment E=1.8e-56

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 73% identity to nar:Saro_1204)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF5361 Membrane protein (Sphingobium sp. HT1-2)
MLEPLQYALGGLSGALVGFVLGLVGGGGSILAVPLLLYLVGVRNPHEAIGTSALAVAANA
LTGLWNHAHARTVNWRCGGIYAAAGVVGALGGSTLGKSIDGHKLLFLFAILMIVVAVLMF
RGRGDQGVEGAQCNRENVGKVVSYGLGTGAFSGFFGIGGGFLIVPGLIASTHMPILRAIG
TSLVAVAAFGLTTALNYALSGYVLWGLAGVFIVGGIVGSVIGTRASQVLAAEKGRLNSLF
AVFVLVVAIYMLFKSWSELAS