Protein Info for GFF5359 in Sphingobium sp. HT1-2

Annotation: Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 6 to 36 (31 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 4 to 322 (319 residues), 326.7 bits, see alignment E=7.8e-102 TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 4 to 212 (209 residues), 143.1 bits, see alignment E=6.9e-46

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 69% identity to mea:Mex_2p1122)

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF5359 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) (Sphingobium sp. HT1-2)
MIDLTVIWACIIGFAIIAYVVMDGFDLGIGILFPFFKVGQDRDTAMNSIAPVWDGNETWL
VMGVGGLFAAFPLAYAIILPALYAPMIAMLLGLVFRGVAFEFRWRDPAHRAFWDKAFTTG
SVVATFAQGIALGALLQGITVEGRSYAGGWWEWLSPFSLLTGVGLLVGYALLGACWLNWK
TEGGLRRQTVTYAGRLGIGLLIMIGVISLATLRLETQYFQRWLSFPGVVATAQVPLATLV
VTFLFYRSLRLKRDAQPFFWALALFGLCLVGLGVSIWPDVVPARVTIWEAAAPVRSQLFM
LVGASIMVPVILAYTAWSYWVFRGKVGIEGYH