Protein Info for GFF5357 in Variovorax sp. SCN45

Annotation: Imidazole glycerol phosphate synthase cyclase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 258 (258 residues), 363.5 bits, E=2.6e-113
• PF00977: His_biosynth
  • amino acids 5 to 242 (238 residues), 281.7 bits, E=4.3e-88

Best Hits

Swiss-Prot: 96% identical to HIS6_VARPS: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 95% identity to vpe:Varpa_1263)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Protein Sequence (259 amino acids)

>GFF5357 Imidazole glycerol phosphate synthase cyclase subunit (Variovorax sp. SCN45)
MLAKRIIPCLDVTGGRVVKGVNFLELRDAGDPVEIAARYNAQGADELTFLDITATSDGRD
LILPIIEAVASQVFIPLTVGGGVRTVADVRRLLNAGADKTSFNSAAIADPNVIDAASQKY
GSQCIVVAIDAKRRTPEEAATRGAGWDVYSHGGRKNTGLDAVEWATEMVRRGAGEILLTS
MDRDGTKSGFDLALTRAVSDAVGVPVIASGGVGNLDDLADGIQNGGADAVLAASIFHYGE
YTVGQAKARMAERGIPVRS