Protein Info for GFF5354 in Variovorax sp. SCN45

Annotation: C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 355 to 360 (6 residues), see Phobius details PF00375: SDF" amino acids 8 to 404 (397 residues), 383 bits, see alignment E=8.8e-119

Best Hits

Swiss-Prot: 42% identical to DCTA_DEIGD: C4-dicarboxylate transport protein (dctA) from Deinococcus geothermalis (strain DSM 11300)

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_1261)

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF5354 C4-dicarboxylate transport protein (Variovorax sp. SCN45)
MKKKLPMAAWILIAMVLGILVGYMIFTSFPDKKAAKEIADYVSIVSDVFLRLIKMLIGPL
VFSTLVVGIAHMGDAKSVGRVFGKAIGWFLTASLISLVIGLIMANLLKPGENLGLPLPDI
GASANLATSKFTLKDFVSHTVPKSFVEAMANNEILQIVVFSMFFGVALASLGDKAKTLVA
AIEELSHAMLKITGYVMKLAPLAVLAAMAATVAVNGLGILIKFAVFMGDFYLGLFVLWSV
LTLAGFLFLGPRVFKLLVLIKEAFLLSFATASSEAAYPKILQALDRFGVKRKISSFVMPM
GYSFNLDGSMMYCTFAVLFIAQAYNIHMPISTQVTMLLILMLTSKGMAGVPRASLVVIAA
TLNHFDIPEAGLLLILGVDTFLDMGRSATNAVGNSIATAVVAKWEGELLSERDAEINAKA
LDEEASATLAHPAHA