Protein Info for GFF535 in Xanthobacter sp. DMC5

Annotation: Lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00215: lipid-A-disaccharide synthase" amino acids 8 to 381 (374 residues), 220.6 bits, see alignment E=1.5e-69 PF02684: LpxB" amino acids 12 to 358 (347 residues), 266.3 bits, see alignment E=2e-83

Best Hits

Swiss-Prot: 59% identical to LPXB_BRADU: Lipid-A-disaccharide synthase (lpxB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 82% identity to xau:Xaut_4426)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF535 Lipid-A-disaccharide synthase (Xanthobacter sp. DMC5)
VTAQDARRPPNIFIVAGEESGDQLGGALMEALAEVAPGTTFRGVGGRRMGASGLESLYPM
DDLTAIGIAAVVGKLPTILRRLKETVEAVLADPPDVLVLVDAPDFTHRVAARVRARNPNI
PIVKYVSPTVWIWRSGRAAAMRPYVDALLALLPFEPEVHRKLGGPPTFYVGHPLLQRLGE
LRPSPAETERRQAKPPLVLVLPGSRRREISRIGADFGAALAEVGRVHEMELVLPTLPRLE
GLVRETIASWPLKPRIVTSEAEKLAAFRSAHASLAASGTVTLELALAGIPHVAAYRIGWL
EAQIGRRVLKGTTVILANLVAGENVVPEFLQEYCTVPALVGALTALLEDSPARRRQEAAF
ARFDDIFGIAGPSPSARAAEVVIRLARDGRPGALPPPA