Protein Info for GFF5349 in Sphingobium sp. HT1-2

Annotation: Multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 21 to 420 (400 residues), 554.4 bits, see alignment E=3.2e-170 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 23 to 49 (27 residues), 19.6 bits, see alignment (E = 8.7e-08) PF07732: Cu-oxidase_3" amino acids 73 to 182 (110 residues), 124.4 bits, see alignment E=4.1e-40 amino acids 545 to 656 (112 residues), 27.1 bits, see alignment E=5.7e-10 PF00394: Cu-oxidase" amino acids 256 to 349 (94 residues), 75.6 bits, see alignment E=7.7e-25 PF07731: Cu-oxidase_2" amino acids 537 to 656 (120 residues), 101.2 bits, see alignment E=6.3e-33

Best Hits

KEGG orthology group: None (inferred from 98% identity to sch:Sphch_4184)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>GFF5349 Multicopper oxidase (Sphingobium sp. HT1-2)
MLRIPNRYALFXXAETNRMISALDRRQFLRGAALAGGGAALSAWLPAWAQTISPGMRPTL
PTVSGEDITLTIARQSMSIDGRQFRAIGXNGTVPAPLIRLREGQRVRLNVVNQLEEDSSI
HWHGLXLPANMDGVPGVSFPGIKPGSNYLYXFPVXQSGTYWYHSHSGLQEQEGHYGPIII
DPAGADPVAYDREHVIVLADHSALSPQAIFRRLKVNPGHFNFQRQTLAGLLSGKDQPLKD
RLDWGQMRMDPADISDVTGSTYTYLVNGHGPMDNWTALFTPGERVRLRVINASAMTTFNV
RIPGLPLTIVQADGQNVVPVTVDEFQXGVAETYDVVVSPGDDKAYTLVGEAIDRSGMARA
TLAPRAGMAGEVPPLRKRPLADMKDMGMDMSSMPGMEGMDMSGGAMRGVDPTAEKNASAR
LATGAAAAMATMDNSAMAGMDHSGMDHSAMSGMDHGAMGADGQMAGMDHGGHAMGSMKMR
DFSNAPQVKRDPSVQTISPMPVDRTGEPGQGLADVGHKVLVYRDLMALDRNPDVRAPSRS
IDIHLTGNMERFMWSFDGEKMSDHHEPIXFIEGERVRVNLINDTMMGHPIHIHGHFFELV
TGHGDHAPRKHTVIVQPGGKVTWDFTADAVGDWAFHCHLLYHMHAGMMRVVSVRPKGDA