Protein Info for GFF5349 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Heat shock (predicted periplasmic) protein YciM, precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13432: TPR_16" amino acids 54 to 91 (38 residues), 25 bits, see alignment 7.6e-09 PF13176: TPR_7" amino acids 74 to 101 (28 residues), 27.6 bits, see alignment (E = 6.8e-10) PF18073: Rubredoxin_2" amino acids 348 to 372 (25 residues), 38.4 bits, see alignment (E = 2.8e-13)

Best Hits

KEGG orthology group: None (inferred from 64% identity to dia:Dtpsy_1388)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>GFF5349 Heat shock (predicted periplasmic) protein YciM, precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDFDFTWLLWGLPLAFALGWVASRFDLRQWRMEGRQAPKAYFRGLNHLLNEQQDQAIDAF
IEAVQGDPDTAELHFALGNLFRRRGDYDRAVRVHEHLLSRADISRKDRDRAQHALALDFL
KAGLLDRAETALHKLQGSDFEGEALLALLGIYERSRDWPQAKRIAQRLEDAEQGSFATRL
AHYLCEEAELAQRGGDSATALQRLNEAVQRAPQLARGWMALSALKTQAGDASGAFDALLR
MNQHAPQSLPLAARALADLARQTGREADALKLLQASHDRAPAIDVTEALASLSSGTEAVR
SRYLSHLEREPSLVITTEWMAGETLSNPTAQASVQKALEHASAPLRRYRCAACGFEARQH
FWQCPGCQAWDSYPARRVEEL