Protein Info for PS417_27375 in Pseudomonas simiae WCS417

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF00085: Thioredoxin" amino acids 7 to 106 (100 residues), 118.8 bits, see alignment E=1.5e-38 TIGR01068: thioredoxin" amino acids 10 to 108 (99 residues), 125.9 bits, see alignment E=3.1e-41 PF13098: Thioredoxin_2" amino acids 20 to 105 (86 residues), 34 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 82% identical to THIO_PSEAE: Thioredoxin (trxA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 98% identity to pfs:PFLU5901)

MetaCyc: 68% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U340 at UniProt or InterPro

Protein Sequence (109 amino acids)

>PS417_27375 thioredoxin (Pseudomonas simiae WCS417)
MSNDLIKHVTDATFEAEVLKAQGPVLVDYWAEWCGPCKMIAPVLDDIATTYEGKLTIAKL
NIDDNQETPAKHGVRGIPTLMLFKDGNVEATKVGALSKSQLQAFLDANI