Protein Info for GFF534 in Xanthobacter sp. DMC5

Annotation: UDP-2,3-diacylglucosamine pyrophosphatase LpxI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF17930: LpxI_N" amino acids 38 to 166 (129 residues), 110.1 bits, see alignment E=7.8e-36 PF06230: LpxI_C" amino acids 169 to 305 (137 residues), 152.3 bits, see alignment E=6.6e-49

Best Hits

KEGG orthology group: K09949, hypothetical protein (inferred from 83% identity to xau:Xaut_4427)

Predicted SEED Role

"Protein of unknown function DUF1009 clustered with KDO2-Lipid A biosynthesis genes" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF534 UDP-2,3-diacylglucosamine pyrophosphatase LpxI (Xanthobacter sp. DMC5)
VGLPGEDGHGRAAAAACGPDAAGLGASQKPTPHGKGPLGIVAGGGSFPAAVAEAAAADGR
EVVLFLIQGFADPALERWPHHWFRLGSLGSVTSWAKARGVREVVMVGALTRPRMRDLGFD
FTMLRLLPRIARLFRGGDNHLLSGVLGLVSEQGFTLVGAHEVAPRLLLPQGVLGALQPTE
TQEADIARGLDVIRALGPFDVGQGVIVVDGLVAAVEAAEGTDQMLARYGEMRRSGRLRFA
AGKGVLVKAPKPGQDRRVDLPSLGPQTVTRAAEVGLAGIAFEAGGAIVPDAQALVEAADA
AGLFVAGIGGRGA