Protein Info for GFF534 in Sphingobium sp. HT1-2

Annotation: Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 1 to 216 (216 residues), 254 bits, E=4.9e-80
• PF01144: CoA_trans
  • amino acids 9 to 216 (208 residues), 246.6 bits, E=9.2e-78

Best Hits

Swiss-Prot: 66% identical to SCOA_XANCB: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (lpsI) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 94% identity to swi:Swit_5023)

MetaCyc: 60% identical to succinyl-CoA-transferase subunit A (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• ketolysis (3/3 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• toluene degradation III (aerobic) (via p-cresol) (5/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5, 2.8.3.6

Use Curated BLAST to search for 2.8.3.5 or 2.8.3.6

Protein Sequence (235 amino acids)

>GFF534 Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5) (Sphingobium sp. HT1-2)
MQKIYDSPRVALDGLLFDGMTIMSGGFGLSGNPESLIPEIRASGVKDLTVISNNAGADGF
GLWMLLESRQVKKMISSYVGENKLFESQYLSGELELELNPQGTLAERIRAGGAGIPAFYT
KTGVGTVVAEGKPVENFEGEDYVRETWLRADLSIIKAWRADPAGNLMFRKTARNFNPNMA
TAGKVTVVEVEEIVPEGSFDPDCIHTPGIYVDRIVLSTINEKRIEKLTVREREAA