Protein Info for GFF5335 in Variovorax sp. SCN45

Annotation: Phospholipid ABC transporter permease protein MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 50 to 76 (27 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 149 to 179 (31 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 25 to 258 (234 residues), 265.6 bits, see alignment E=2.6e-83 PF02405: MlaE" amino acids 46 to 255 (210 residues), 243.5 bits, see alignment E=9e-77

Best Hits

Swiss-Prot: 59% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 98% identity to vpe:Varpa_1241)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF5335 Phospholipid ABC transporter permease protein MlaE (Variovorax sp. SCN45)
MSWWKPADVGFAVRRHLANLGYGAKLFMRLVGPGARIMRRFGLVRDQIHFLGNYSLAIIG
VSGLFVGFVLGLQMYYALQRYGSSEALGLLVTLSLVRELGPVVAALLFTGRAGTSLTAEI
GLMKADEQLSAMEMMAVDPVQRILAPRFWAGVITMPLLAAVFSAVGIMGGYVVGVLMLGV
DPGAFWGQMQGGVDVWRDVGNGVIKSIVFGFTVTFIALLQGYEAQPTPEGVSRATTKTVV
TASLAVLGLDFLLTAMMFSI