Protein Info for GFF5334 in Variovorax sp. SCN45

Annotation: Phospholipid ABC transporter ATP-binding protein MlaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00005: ABC_tran" amino acids 26 to 175 (150 residues), 100 bits, see alignment E=9.5e-33

Best Hits

Swiss-Prot: 60% identical to MLAF_HAEIN: Intermembrane phospholipid transport system ATP-binding protein MlaF (mlaF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 92% identity to vpe:Varpa_1240)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF5334 Phospholipid ABC transporter ATP-binding protein MlaF (Variovorax sp. SCN45)
MDPATQPHPFVEFRDVTFGYGARAILDGVSFSVPRGKVTALMGASGGGKTTVLRLIGGQQ
RAQRGAVLFDGQDVVRFDAAALYAARRRMGMLFQFGALFTDMSVFDNVAFPLREHTQLSE
ALVRDIVLMKLDAVGLRGARDLMPSEVSGGMARRVALARAIALDPDLVMYDEPFAGLDPI
SLGTAARLIRQLNDTLGLTSIIVSHDLEETFRIADHVIILANGGIAAQGVPDDVRNSADP
LVHQFVNALPDGPVRFHYPGVSIEADFGNVEGGRS