Protein Info for GFF5329 in Sphingobium sp. HT1-2

Annotation: Dihydropteroate synthase (EC 2.5.1.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR01496: dihydropteroate synthase" amino acids 16 to 283 (268 residues), 316.4 bits, see alignment E=8.4e-99 PF00809: Pterin_bind" amino acids 17 to 269 (253 residues), 283.5 bits, see alignment E=8.2e-89

Best Hits

Swiss-Prot: 39% identical to DHPS_ECOLI: Dihydropteroate synthase (folP) from Escherichia coli (strain K12)

MetaCyc: 39% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.15

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF5329 Dihydropteroate synthase (EC 2.5.1.15) (Sphingobium sp. HT1-2)
MSTTLTSFKWGERTYIMGILNVTPDSFSGDGVMVEEDVIAKAVAQAKQFVADGADIIDIG
GESTRPGSSPISAEEELARVLPVVQAVRQAVDVVISIDSYRASVAEAALAAGASWLNDVW
GLRMDPDMAGLAAQAGCPIVLMHNRSKPKNIAQEKKLGGRFIGVKYDDLITDVKRELQES
IDIALKAGVKESQIILDPGIGFGKTVEQSLQLLDQINQFKTMGFPILIGPSRKSFIGYTL
DLPPDQRIEGTAATVAIGIDRGADVVRVHDVKAIVRVARMTDAIVRR