Protein Info for PS417_27265 in Pseudomonas simiae WCS417

Annotation: iron ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 28 to 283 (256 residues), 56.6 bits, see alignment E=6.9e-19 PF01547: SBP_bac_1" amino acids 33 to 280 (248 residues), 64.1 bits, see alignment E=4.5e-21 PF13416: SBP_bac_8" amino acids 42 to 307 (266 residues), 76.6 bits, see alignment E=5.9e-25 PF13343: SBP_bac_6" amino acids 75 to 299 (225 residues), 65.9 bits, see alignment E=8.1e-22

Best Hits

Swiss-Prot: 82% identical to P5217_PSEAE: Probable binding protein component of ABC iron transporter PA5217 (PA5217) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU5876)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UTN9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PS417_27265 iron ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MLAPKRLLTALALTLIGSTTVQAADEVVVYSSRIDELIKPVFDAYTQKTGVQVKFITDKE
APLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSPVIDKNIPLQYRSSKHTWT
GLSLRARTIAYSTDRVKPGDLTTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAA
KTEEIVKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNTYYYGRLHKQKPDLAVKLFWP
NQGDRGVHVNLSGIGLTQHAPHPEAAKALVEWMTTPEAQKIFADVNQEFPANPAVAPSAE
VASWGKFVADTLPVEVAGKRQAEAIRLMDRAGWN