Protein Info for GFF532 in Sphingobium sp. HT1-2

Annotation: Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR03232: benzoate 1,2-dioxygenase, small subunit" amino acids 17 to 171 (155 residues), 258.4 bits, see alignment E=1.1e-81 PF00866: Ring_hydroxyl_B" amino acids 23 to 163 (141 residues), 140.1 bits, see alignment E=2.8e-45

Best Hits

Swiss-Prot: 58% identical to CBDB_BURCE: 2-halobenzoate 1,2-dioxygenase small subunit (cbdB) from Burkholderia cepacia

KEGG orthology group: K05550, benzoate 1,2-dioxygenase beta subunit [EC: 1.14.12.10] (inferred from 68% identity to swi:Swit_2635)

MetaCyc: 58% identical to 2-halobenzoate 1,2-dioxygenase small subunit (Burkholderia cepacia 2CBS)

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>GFF532 Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10) (Sphingobium sp. HT1-2)
MTLVLDTERAALSYQDICAFLYREARLLDDRELDEWLECYSEQCEYWMPAWTDDDALTTD
PHSEISLIYYGNRKGLEDRVYRLKTERSSASTPEARTSHFLANIEVIETRSDAIDLRYNW
HTMSHRYQKTQQFFGTSFVTLDISGAAPKILKKTIVLKDDYIHQVIDVYHI