Protein Info for PS417_27230 in Pseudomonas simiae WCS417

Annotation: membrane protein implicated in regulation of membrane protease activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 7 to 48 (42 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details PF01957: NfeD" amino acids 94 to 146 (53 residues), 38.6 bits, see alignment E=5.1e-14

Best Hits

Swiss-Prot: 44% identical to YBBJ_ECOLI: Inner membrane protein YbbJ (ybbJ) from Escherichia coli (strain K12)

KEGG orthology group: K07340, hypothetical protein (inferred from 96% identity to pfs:PFLU5869)

Predicted SEED Role

"Putative activity regulator of membrane protease YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAR7 at UniProt or InterPro

Protein Sequence (148 amino acids)

>PS417_27230 membrane protein implicated in regulation of membrane protease activity (Pseudomonas simiae WCS417)
MWDFLQHLSFWDWLALGTVLLILEVFGAGGYLLWMGIAAAAVGVIKFLVPPLGLEWQLLL
FAVLSILTAVYWWRRQRSSAKASDQPGLNERGSELIGRTFVVHQAIVDGRGKIKVGDGVW
MVTGPDSAAGAQVRVIGQEGVVLRVETV