Protein Info for GFF531 in Xanthobacter sp. DMC5

Annotation: UDP-3-O-acylglucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 32 to 349 (318 residues), 355.4 bits, see alignment E=1.2e-110 PF04613: LpxD" amino acids 41 to 106 (66 residues), 48.5 bits, see alignment E=6.3e-17 PF00132: Hexapep" amino acids 135 to 168 (34 residues), 31.3 bits, see alignment 1.2e-11 amino acids 152 to 185 (34 residues), 27.4 bits, see alignment 2e-10 amino acids 246 to 281 (36 residues), 32.8 bits, see alignment 4e-12

Best Hits

Swiss-Prot: 69% identical to LPXD_AZOC5: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 86% identity to xau:Xaut_4430)

MetaCyc: 47% identical to UDP-3-N-(acyl)-alpha-3-amino-3-deoxy-D-glucosamine N-acyltransferase (Brucella abortus 2308)
RXN2B4Q-50 [EC: 2.3.1.191]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF531 UDP-3-O-acylglucosamine N-acyltransferase (Xanthobacter sp. DMC5)
MSHDLFFPLPEPLTLAEVAALSGARLAASNPAEEAELGARHISGLGTLETAGPDELAFCD
SFLFAEKLGSVRAGALITSERFAPKAPAGLPLLIAPRPAAAFLAVSRRMFPAALRPLPIF
GHEGVAPGAQVHPKARLEDGVTIDPGAVIGPGAEVGAGTVICAGAIVGPNVRIGRNCAIG
PGASVIHAYLGNGVIIHAGARIGSDGFGYQPSPAGHVKVPQLGRVVVQDNAEIGANTTID
RGAITDTVIGEGSKIDNLVQIAHNVVIGRHCIVVSQTGISGSTTLGDFVMLGGQVGVVGH
VTIGTGAQIAASSNVKGDVPPGVRWGGSPAKPVREWFREVATLKRIAAAGARRGKDDEEG
EGPQE