Protein Info for GFF531 in Sphingobium sp. HT1-2
Annotation: Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to CBDA_BURCE: 2-halobenzoate 1,2-dioxygenase large subunit (cbdA) from Burkholderia cepacia
KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 80% identity to swi:Swit_2634)MetaCyc: 59% identical to 2-halobenzoate 1,2-dioxygenase large subunit (Burkholderia cepacia 2CBS)
Predicted SEED Role
"Ring hydroxylating dioxygenase, alpha subunit (EC 1.14.12.13)" in subsystem Benzoate degradation (EC 1.14.12.13)
MetaCyc Pathways
- benzoate degradation I (aerobic) (2/2 steps found)
- 2-chlorobenzoate degradation (1/1 steps found)
- mandelate degradation to acetyl-CoA (11/18 steps found)
- meta cleavage pathway of aromatic compounds (5/10 steps found)
- toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
- superpathway of aerobic toluene degradation (10/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Fluorobenzoate degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.12.10
Use Curated BLAST to search for 1.14.12.10 or 1.14.12.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (453 amino acids)
>GFF531 Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10) (Sphingobium sp. HT1-2) MTSPMAFLRDRVETAVVDDPETGIFRCRRDVFTDPELFDLEMKYIFESNWVYLAHESQVE KKNDYFTTWIGHTPVILTRAKDGGLNCVVNACAHRGAKLCRRKRGNQPLFVCPFHGWSFK TDGKLLRAKDASTGAYPDSFDHEGSHDLTRVRVESYRGFIFGSLNHDVLPLEDHLGEAKV IIDQMVDQAPEGLEVLTGNSTYTFHGNWKMQMENGCDGYHVSSVHENYQSTMGRRAEGGT KAVDANGWSKAPASGVYGFEHGHILLWTQVLNPEVRPVWNYKDQLVERLGEDKARFILEQ TRNLALYPNVFLMDQFSTQIRVVRPIDVHTTEVTIYCYAPKGESAEDRAHRIRQYEDFFN VTGMGTPDDLEEFRSCQSAYEGAGELWNDLSRGATRWIAGPDSNATAMGMKPLLSSERSE DEGLFVRQHEFWAQIMLDGMAREAGAPMMEAAE