Protein Info for PS417_27170 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13379: NMT1_2" amino acids 30 to 256 (227 residues), 51.3 bits, see alignment E=3.1e-17 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 32 to 313 (282 residues), 258.5 bits, see alignment E=3.7e-81 PF04069: OpuAC" amino acids 50 to 237 (188 residues), 49.9 bits, see alignment E=7.1e-17 PF12974: Phosphonate-bd" amino acids 53 to 188 (136 residues), 33.7 bits, see alignment E=5.1e-12 PF09084: NMT1" amino acids 57 to 250 (194 residues), 69.1 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU5857)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2Z6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PS417_27170 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MRTVILRRGLVALFAAAVSFGAIVQAQAAETLRIGYQKYGTLVLLKAKGTLEKRLAAQGV
NVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYVAYEPPAPTSEAILVP
KDSPIKSVAELKGKKVVLNKGSNVHYLLVRALEDAGLKYTDVQAVFLPPADARAAFERGS
VDAWVIWDPYQAAAEKQLQARTLRDGTGIADNHQFYLATKPYAQQHPEVIKALVEEVRAV
GEWSKANPQEVTEQVAPLLGLPADITLTSVKRQGYGALFLTPEVVAAQQKIADSFYQLKL
IPKPLNIKDVIWTPPAAVATAP