Protein Info for GFF5305 in Variovorax sp. SCN45

Annotation: S-adenosylmethionine synthetase (EC 2.5.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 5 to 101 (97 residues), 140 bits, E=5e-45
• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 390 (385 residues), 590 bits, E=9.5e-182
• PF02772: S-AdoMet_synt_M
  • amino acids 118 to 239 (122 residues), 158.2 bits, E=1.4e-50
• PF02773: S-AdoMet_synt_C
  • amino acids 241 to 379 (139 residues), 228.4 bits, E=3.8e-72

Best Hits

Swiss-Prot: 98% identical to METK_VARPS: S-adenosylmethionine synthase (metK) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 98% identity to vap:Vapar_1126)

MetaCyc: 59% identical to S-adenosylmethionine synthase monomer (Helicobacter pylori 26695)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle III (6/11 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (395 amino acids)

>GFF5305 S-adenosylmethionine synthetase (EC 2.5.1.6) (Variovorax sp. SCN45)
MANDFLFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAETLTNTGLVVLAGEITT
NAHVDYIQVARDTIKRIGYDNTDYGIDYKGCAVMVCYDKQSNDIAQGVDHASDDHLNTGA
GDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGK
PHSIDTVVLSTQHSPDQSETPTKMKASFNEAIIEEIIKPVLPKEWLKDTRYLINPTGRFV
IGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLA
RQCQIQVAYAIGVAQPMNITVYTEGTGVISDEKIAELVREHFDLRPKGIIQMLDLLRPIY
QKTAAYGHFGREEPEFTWEATNQAAALRAAAGIKG