Protein Info for GFF5301 in Sphingobium sp. HT1-2

Annotation: Thymidylate kinase (EC 2.7.4.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR00041: dTMP kinase" amino acids 4 to 196 (193 residues), 141.8 bits, see alignment E=1.1e-45 PF02223: Thymidylate_kin" amino acids 9 to 196 (188 residues), 131.2 bits, see alignment E=3.6e-42

Best Hits

Swiss-Prot: 67% identical to KTHY_SPHWW: Thymidylate kinase (tmk) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00943, dTMP kinase [EC: 2.7.4.9] (inferred from 83% identity to sjp:SJA_C1-16600)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>GFF5301 Thymidylate kinase (EC 2.7.4.9) (Sphingobium sp. HT1-2)
VITGRFITLEGGEGAGKSTQLRALAAALRARGLEVVETREPGGSEGAEAIRAMLLTGGAD
RWNARAEALLFAAARADHIEKTIRPALARGAWVLSDRFLDSSRAYQGQGELSDADILALH
QIGSAGFLPDRTLFLTLPETEAEARAHARDGDVSDRIGGRDRAFHRAVADAFVRFAADEP
TRVRAIDASGAADDVTARLLAALNDLLS