Protein Info for GFF5300 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 114 to 284 (171 residues), 94 bits, see alignment E=5e-31

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 81% identity to bch:Bcen2424_0032)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF5300 ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) (Variovorax sp. SCN45)
MTPSTTTPTAAVLPSSLSDAALARESEVAQAAIRGRRRMIIGLRLAVLIVALGGWEIAAR
LKWIDPFFYSMPSMIYDQLVEWMRDGTSQGSLWMQVAVTLEETVIGFLIGSVAGVLCGII
LGRNKLLSDVFSLYIQIANSIPRVVLGSIFVIALGLGMASKVALAVVMVFFVVFGNAFQG
VREADKYMIANAQILGASPRQVTMSVVIPSAMSWILASLHVSFGFALVGAVVGEFLGAKE
GIGLLISTAQGAFNASGVFAAMIVLAVVALAADFLLSSLEKRLLKWRPAAF