Protein Info for GFF530 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: NAD(FAD)-utilizing dehydrogenase, sll0175 homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 transmembrane" amino acids 131 to 150 (20 residues), see Phobius details PF28550: DUF8436" amino acids 36 to 82 (47 residues), 36.5 bits, see alignment 7e-13 PF21688: FAD-depend_C" amino acids 323 to 418 (96 residues), 152.2 bits, see alignment E=3.1e-48 amino acids 451 to 552 (102 residues), 101.7 bits, see alignment E=9.6e-33

Best Hits

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (607 amino acids)

>GFF530 NAD(FAD)-utilizing dehydrogenase, sll0175 homolog (Hydrogenophaga sp. GW460-11-11-14-LB1)
MIRLSELKLPLAAVPAEHRRAADAPTETEVDRQPPPHPLEALTGLAATALGIEAAQIAQL
EVFKRSFDARKADLLAVYIVDVTLADPAQEATLLAAHAGKPHIQPTPDMTWHAPGHAPAH
WPGDESERPVVVGLGPCGLFAALALAQMGLRPIVLERGKPVRERTKDTWGLWRKQVLNPE
SNVQYGEGGAGLFSDGKLYSQIKDPRFLGRKVMHEFVEAGAPPEILYTAHPHIGTFKLVR
VVEAMREKIVALGGEIRFQHQVCGIGLAGEGEDQRVDRLTVRRLDSGDTLDMPVRHVVLA
LGHSSRDTFALLWDAGVFMEAKPFSIGFRIEHPQGVIDRARWGRHAGHPLLGAADYKLVH
HAKNGRAVYSFCMCPGGTVVAATSEPGRVVTNGMSQYSRNERNANAGLVVGIEPSDFPQA
FPSDLPLWTAAFGEADGARYAGQAAALAPQGRTHPLAGIVLQRQLESRAYQLGGHSYEAP
GQLVGDFLKQTPSSALGEVQPSYRPGVKLGDLAPALPAYAIEAMREALPVFGRKMRGYDM
PDAVLTGVETRTSSPLRLTRGDDCQSLNTRGLYPAGEGAGYAGGILSAGVDGLRVAEALA
RELLKAA