Protein Info for GFF529 in Xanthobacter sp. DMC5

Annotation: Metalloprotease MmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 120 to 147 (28 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details PF02163: Peptidase_M50" amino acids 25 to 370 (346 residues), 236.1 bits, see alignment E=6.2e-74 TIGR00054: RIP metalloprotease RseP" amino acids 26 to 224 (199 residues), 148.7 bits, see alignment E=1.1e-47 PF13180: PDZ_2" amino acids 155 to 216 (62 residues), 37.3 bits, see alignment E=5.6e-13 PF00595: PDZ" amino acids 155 to 191 (37 residues), 24.5 bits, see alignment 5.6e-09 PF17820: PDZ_6" amino acids 156 to 208 (53 residues), 38.8 bits, see alignment 1.3e-13

Best Hits

Swiss-Prot: 54% identical to Y1380_AGRFC: Putative zinc metalloprotease Atu1380 (Atu1380) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 89% identity to xau:Xaut_4432)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF529 Metalloprotease MmpA (Xanthobacter sp. DMC5)
MDVISGLGANLGTLSSTLLGYVIPFLFVLTLVVFFHELGHFWVARRAGVRVVTFSLGFGP
EIAGFNDKHGTRWRIAAIPLGGYVRFFGDEDAASTPDSARLSQMTAAERNESFFYKPVAW
RAAIVAAGPIANFLLAIAIFAIVFMVFGKQVTAPRVDQINPGSAAEMAGFKPGDLVLEID
GAKVDSFSDMQRIVGSHAGQPLAFTVTRGDREVTLTATPELKEVKDPFGNSHRTGLLGIS
RSLAAGDVTTQRFGPVEAIGMGVQETWFVVARTFDYLGGLVAGRESADQLGGPIRIAQVS
GQVATFGIGALLSLAAVLSVSIGLLNLFPIPLLDGGHLLFYAFEAIRGRPLSARTQDIGF
RIGLALVLMLMIFATWNDVLHIAAM