Protein Info for GFF529 in Sphingobium sp. HT1-2

Annotation: Muconolactone isomerase (EC 5.3.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02426: MIase
  • amino acids 1 to 90 (90 residues), 130.3 bits, E=1.2e-42
• TIGR03221: muconolactone delta-isomerase
  • amino acids 2 to 91 (90 residues), 133.9 bits, E=8.2e-44

Best Hits

Swiss-Prot: 60% identical to CATC2_ACILW: Muconolactone Delta-isomerase 2 (catC2) from Acinetobacter lwoffii

KEGG orthology group: K03464, muconolactone D-isomerase [EC: 5.3.3.4] (inferred from 73% identity to swi:Swit_0976)

MetaCyc: 57% identical to muconolactone isomerase subunit (Pseudomonas putida)
Muconolactone Delta-isomerase. [EC: 5.3.3.4]

Predicted SEED Role

"Muconolactone isomerase (EC 5.3.3.4)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)

MetaCyc Pathways

• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (11/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.4

Protein Sequence (96 amino acids)

>GFF529 Muconolactone isomerase (EC 5.3.3.4) (Sphingobium sp. HT1-2)
MLFMVEMDVNIPLDFDAAEAARIKAAEKAYFQTLQAAGTWRHIWRKVGLYSNVSIFDVES
NAALHDTLMALPLYPFMTMKITPLCRHPSSIHEDDR