Protein Info for GFF5286 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF00239: Resolvase" amino acids 2 to 136 (135 residues), 143.4 bits, see alignment E=8.3e-46

Best Hits

Swiss-Prot: 47% identical to PINE_ECOLI: Serine recombinase PinE (pinE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to amv:ACMV_P4_00310)

MetaCyc: 47% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

"Resolvase, N-terminal domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF5286 hypothetical protein (Sphingobium sp. HT1-2)
MMIGYARVSTQGQDLDQQRAALGAAGCVRMFEEKASGAKRDRPELARMLDHLRAGDVVTI
ARLDRLARSTGDLLSIAERIKEAGAGLRSLAEPWADTTTPAGRMVLTVFAGIADFERSLI
VERTSAGRIAAKARGVRFGPSPTLSAEQIAHAHQLIDQDKKPVAEVARLLGVHRATLYRA
LNDALTR