Protein Info for GFF5274 in Variovorax sp. SCN45

Annotation: Various polyols ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 262 (169 residues), 56.2 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 34% identical to Y4OR_SINFN: Probable ABC transporter permease protein y4oR (NGR_a02180) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 98% identity to vpe:Varpa_1193)

MetaCyc: 60% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF5274 Various polyols ABC transporter, permease protein 2 (Variovorax sp. SCN45)
MQQQQAPSNFLPQLLRTVGAWAVTLVLFFPLGWLFLTAFKTELQAISVPPLFIFEPTLDN
FGEVQRRSDYLLYARNSLITSLGSTILGLLIAAPAAYSMAFFRTKKTRDILMWMLSTKMM
PAVGALVPIYVLAQTAGMLDSLPALTIVFTLSNLPIMVWMLYSAYKDIPNEILEAARMDG
ASLWTEFRHVVLPLSVGGLASTGLLCLVLSWNEAFWALNLTSAKAGTLATLIASYSSPEG
LFWAKLSAASLMAIAPIVVFGWFSQKQLVQGLTFGAVK