Protein Info for PS417_02685 in Pseudomonas simiae WCS417

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 265 (254 residues), 85.9 bits, see alignment E=1.4e-28 PF01545: Cation_efflux" amino acids 13 to 209 (197 residues), 117.5 bits, see alignment E=3.3e-38

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU0558)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1G0 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PS417_02685 cation diffusion facilitator family transporter (Pseudomonas simiae WCS417)
MSNRGEQALLKQSTILMFAVAIAGIVTGVVSGAQSILFDGFFSLIATAIKVLMLITAKLI
AKKSNERFQFGYWHLEPMVLLIEGSFLLLIAIYAFLNGVFGIINGGREIELGLVIIYAAV
FTVVEFAYFFYVRYRNRQLKSSLIQFDNISWLVDAMLSVGLLISFLAALLLKSQGYGEWA
VYVDPLILILLALSMLAPAFKILRPALREVLGIAPDQLDDKVREVMDAAQARHGFDDYVS
YVQKHGRARFIEIHVVLPADYPVDNVATLDGLREEISTGLGTPDTARWLTISFTGDRKWI
A