Protein Info for GFF5264 in Variovorax sp. SCN45

Annotation: Spermidine/putrescine import ABC transporter ATP-binding protein PotA (TC 3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 124.2 bits, see alignment E=8.7e-40 PF08402: TOBE_2" amino acids 274 to 345 (72 residues), 37.3 bits, see alignment E=3.8e-13

Best Hits

Swiss-Prot: 46% identical to UGPC_RHILO: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 93% identity to vap:Vapar_1099)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF5264 Spermidine/putrescine import ABC transporter ATP-binding protein PotA (TC 3.A.1.11.1) (Variovorax sp. SCN45)
MNGIEFRNITKRYGTDKNAPLAVKGISFEVPVGTLTTILGPSGCGKTTTLRMIAGLESPT
SGAIFMGGRDVTTLGPAERNVSMMFQSYALFPHMNVIENVGYGLRMSGVKKDEATARARE
ALRGVGLVGFDERLPSELSGGQQQRVALARALVLEPAVLLFDEPLSNLDARLRREMREEI
RALQQRLKLTVAYVTHDQSEALAVSDQIIVMDHGVIAQRGTPEQLYGRPESEFVAGFMGE
ASVFPATAQPDGSVAMGPLRLQPRHAVAPGAVKVAVRPEAWRIGAGGAADGLPATLRKAA
YLGSFYEYGFDTTLGPVFVVSTDLSRPLAAGAQATLSLGAHGVSVVPGA