Protein Info for GFF5263 in Variovorax sp. SCN45

Annotation: Ferric iron ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 427 to 448 (22 residues), see Phobius details amino acids 477 to 501 (25 residues), see Phobius details amino acids 517 to 538 (22 residues), see Phobius details amino acids 544 to 564 (21 residues), see Phobius details amino acids 576 to 596 (21 residues), see Phobius details amino acids 604 to 624 (21 residues), see Phobius details amino acids 664 to 687 (24 residues), see Phobius details amino acids 708 to 732 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 258 to 443 (186 residues), 54 bits, see alignment E=9.2e-19 amino acids 556 to 729 (174 residues), 43.9 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 94% identity to vpe:Varpa_1182)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (757 amino acids)

>GFF5263 Ferric iron ABC transporter, permease protein (Variovorax sp. SCN45)
VEARAIEGAPVNPASLAAARRSQRWIWAWVAMGLAAYLLLPWYAIQDSTWYEAVPQVFSQ
AEGANGLMQAATQGRGWLFIGLAGLLLCAVGAWLPAGKAQGRWLLAGGLVGALGLAATGF
TIGARGWSFAAFNTQFGELAVNQFGIGAGGFLALTALVLLMAFGIARLGLFKGDLFVAAA
VVGCGVLMALFIAYPVSKALSGAFFNEDGQWSITAFVARVFTERIWGLGCLSGGVRCGVA
WNTLVLALLTAAGTTFLGTLMALMAERGSKRGQGALRVLALLPIITPPFVVGLGLILLFG
RAGIVNQVLESVFGIEPTRWFYGMPGVLVAQLFAFTPIAFMIMRGVVQGIAPSLEEAAQM
LRADRRRTFFTITLPLLKPGLANAFLVGFIESIADFGNPVVVGGQFSVLSTDIFFAIVGA
QYDQGRAASLAWVLTLFALGVFALQRGLLGKQNYTTVSGKGDAGIAMALPDGVRRTIYCI
AMPWIAFTAVVYLFAFAGGFVQTWGRDYSFTLNHFKSAFALEWGQFGLVWAGTAWNSLIT
TLKLAGISAPITAALGLLIAWLLARNEFKGQGLFEFGALLAFAIPGTVLGVSYILAFNVP
PFELTGTGLIIVLCFMFRNLPVGVRAGTAAFKQLDRSLDEASLMLRASTSQTLFKVVLPL
LKPALVAALVYSFVRAMTTVSAVIFLVTAENELATTYIIGRVGNGDYGIALAYCTVLMIL
MSLAIALVQFVVGERKLGRRGATPQQHQGHHKMEGLA