Protein Info for GFF526 in Xanthobacter sp. DMC5

Annotation: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 35 to 262 (228 residues), 262.5 bits, see alignment E=1.5e-82 PF01255: Prenyltransf" amino acids 42 to 262 (221 residues), 275 bits, see alignment E=2.3e-86

Best Hits

Swiss-Prot: 61% identical to ISPT2_BRADU: Isoprenyl transferase 2 (uppS2) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 86% identity to xau:Xaut_4435)

MetaCyc: 47% identical to (2Z,6E)-farnesyl diphosphate mono-trans,poly-cis-dodecaprenyl diphosphate synthase (Thermobifida fusca)
RXN-11487 [EC: 2.5.1.88]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31 or 2.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>GFF526 Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (Xanthobacter sp. DMC5)
MTLRAASDAAVPGRPSPATPASAGQPTPAPAGQCVPVHVGVIMDGNGRWATSRKLPRVEG
HRRGVEALRRCVRAAREIGIRFLTIYSFSAENWSRPVTEVTELMRLLKFFLRHDLAELNS
ANVRVKVIGERAALAPDIRQLLDDAEALTCTNTGLTLVVAFNYGARQEIASAVARIAADV
AAGRVKPEDVDVAMISQRLETAGIPDPDLIVRTSGEQRLSNFLLWQAAYSEFVFLPIYWP
DFDKAALIAAIDEYARRDRRFGGVTPRPGP