Protein Info for GFF526 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 913 transmembrane" amino acids 563 to 582 (20 residues), see Phobius details amino acids 718 to 741 (24 residues), see Phobius details amino acids 768 to 791 (24 residues), see Phobius details amino acids 797 to 819 (23 residues), see Phobius details amino acids 826 to 846 (21 residues), see Phobius details amino acids 887 to 908 (22 residues), see Phobius details PF00005: ABC_tran" amino acids 28 to 176 (149 residues), 98.3 bits, see alignment E=1.5e-31 amino acids 293 to 436 (144 residues), 105.8 bits, see alignment E=7.4e-34 PF12679: ABC2_membrane_2" amino acids 559 to 910 (352 residues), 42.3 bits, see alignment E=1.5e-14 PF12698: ABC2_membrane_3" amino acids 571 to 905 (335 residues), 143.5 bits, see alignment E=2.4e-45 PF01061: ABC2_membrane" amino acids 725 to 876 (152 residues), 66.1 bits, see alignment E=8.2e-22

Best Hits

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 66% identity to avn:Avin_16780)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (913 amino acids)

>GFF526 ABC-type multidrug transport system, permease component (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTSLTLVPVPPVAQLEGVSQHYGKTVALNNITLDIPARSMVGLIGPDGVGKSSLLSLISG
ARVIEQGNVIVLGGDMRDAKHRRDVCPRIAWMPQGLGKNLYHTLSVYENVDFFARLFGHD
KAEREARITELLNSTGLAPFRDRPAGKLSGGMKQKLGLCCALIYDPELLILDEPTTGVDP
LSRAQFWDLIDSIRQRQTNMSVLVATAYMEEAERFDWLVAMNAGEILATGSAQQLRAKTH
SATLEQAFIALLPEAQRQAHKPVVIPPYHAEQEEIAIEAKDLTMRFGKFVAVDHVNFRIP
RGEIFGFLGSNGCGKSTTMKMLTGLLPASEGQAWLFGQPVDPNDIDTRRRVGYMSQAFSL
YNELTVRQNLELHARLFHIPPAEIPARVAQMIERFMLTEVEDTLPASLPLGIRQRLSLAV
AVIHRPEMLILDEPTSGVDPVARDMFWQLMVDLSRQDKVTIFISTHFMNEAERCDRMSLM
HAGKVLASGTPQELVQQRGAANLEAAFISWLQEAAGAAPETPIPPSQTPAASGKPSRQGL
SFRRLFSYSRREALELRRDPVRSTLALLGTVILMLIMGYGISMDVENLRFAVLDRDQTVS
SQAWSLNLAGSRYFIEQPPLASYDELDRRMRSGELAVAIEIPPNFGRDIARGTPAQIGVW
VDGAMPSRAETVKGYVQAMHQSWLQEAASRQPNPVKQVGLLNIETRYRYNPDVKSLPAIV
PAVIPLLLMMIPSMLSALSVVREKELGSMINLYVTPTTRSEFLLGKQLPYIALGMLNFLL
LCALSVFVFGVPLKGSFLTLTLAALLYVIIATGLGLLISTFMKSQIAAIFGTSIITLIPA
TQFSGMIDPVASLEGPGRWIGEIYPTSHFLTIARGTFSKALDLSDLWPLFMPLLIAVPVV
MGLSILLLKKQEG