Protein Info for GFF5257 in Sphingobium sp. HT1-2

Annotation: Rhomboid family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details PF07681: DoxX" amino acids 24 to 112 (89 residues), 62.9 bits, see alignment E=3.5e-21 PF04173: DoxD" amino acids 74 to 148 (75 residues), 26.1 bits, see alignment E=7.4e-10

Best Hits

KEGG orthology group: None (inferred from 76% identity to ccr:CC_3257)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>GFF5257 Rhomboid family protein (Sphingobium sp. HT1-2)
MTQFLPLRDAVVRRIEALLPDALLLLVARLGVAAIFFQSGRTKVEGVITITDSTYELFRT
EYALPLVPPGIAATMATWSEHLFPILLVLGLFTRLSAGALLGMTLVIQTFVYPDAWPTHL
SWAAILLPLIAHGGGALSMDALIFPRSKM