Protein Info for PS417_26905 in Pseudomonas simiae WCS417

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to DYR_NEIMA: Dihydrofolate reductase (folA) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 94% identity to pfs:PFLU5803)

MetaCyc: 36% identical to dihydrofolate reductase monomer (Homo sapiens)
Dihydrofolate reductase. [EC: 1.5.1.3]; 1.5.1.3 [EC: 1.5.1.3]

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

folate transformations III (E. coli) (9/9 steps found)
folate transformations II (plants) (10/11 steps found)
superpathway of chorismate metabolism (44/59 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
tetrahydrofolate biosynthesis I (3/3 steps found)
superpathway of tetrahydrofolate biosynthesis (8/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U888 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PS417_26905 diacylglycerol kinase (Pseudomonas simiae WCS417)
MKKTLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRPLP
GRLNLVVSRQTDLVLEGAEVFPSLDAAVERAEEWAKAQGVDELMLIGGAQLYAQGLEQAD
RLYLTRVALSPEGDAWFPEFDVGQWKLVSNLENAAQGDKPAYNFEVWEKA