Protein Info for GFF5253 in Variovorax sp. SCN45

Annotation: Amidohydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR01891: amidohydrolase" amino acids 28 to 392 (365 residues), 333.5 bits, see alignment E=8.4e-104 PF01546: Peptidase_M20" amino acids 90 to 401 (312 residues), 148.3 bits, see alignment E=2.9e-47 PF07687: M20_dimer" amino acids 203 to 297 (95 residues), 25.7 bits, see alignment E=9.2e-10

Best Hits

Swiss-Prot: 39% identical to YXEP_BACSU: Uncharacterized hydrolase YxeP (yxeP) from Bacillus subtilis (strain 168)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 94% identity to vpe:Varpa_1173)

MetaCyc: 39% identical to N-acetyl-sulfur-metabolite deacetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF5253 Amidohydrolase family protein (Variovorax sp. SCN45)
MTAATAEAPRLKASGRAFAHIASFYPEITAFRRDLHAHPELGFEEVYTSGRVREALRACG
VDEIHEGIGKTGVVGIIRGRSTASGRMIGLRADMDALPMREDNDFGWRSASDGLMHGCGH
DGHTAMLVGAARYLAETRDFDGTAVLIFQPGEEGFAGARVMIEDGLFDRFPVNAVYAMHN
WPAMPAGTVGINRGAMMAAADRITISIKGKGGHGAHAYQTIDPVIVAAHIITAAQTIVSR
NVRPIDAAVISICAMQAGDLGAMSVVPGEATLVGTVRTFSSRVQAQVEQRLNELCTAIAS
GFGATATIKYERIYPATINTAPEAMFAADVAESLVGAKNVERSMEPSMGAEDFSFMLQKK
AGAYLRIGQDVRDGAFLHNSRYDFNDEILPLGAALHAGLVEQGMPLAATRGAQPGKAAAT
AAS